PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_03516.1_g00001.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family MYB
Protein Properties Length: 236aa    MW: 27353.7 Da    PI: 9.3773
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_03516.1_g00001.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding53.45.9e-171865148
                             TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
          Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                             +g WT eEd +l+d+v+ +G+g W++I r+ g++R++k+c++rw +yl
  Rsa1.0_03516.1_g00001.1 18 KGLWTVEEDNILIDYVQAHGTGLWNRIVRKTGLKRCGKSCRLRWINYL 65
                             678*******************************************97 PP

2Myb_DNA-binding62.21.1e-1971116148
                              TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
          Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                              +g++T++E++l+++++k+lG++ W++Ia++++ gRt++q+k++w+++l
  Rsa1.0_03516.1_g00001.1  71 KGNFTEQEEDLIIRLHKLLGNR-WSLIAKRVP-GRTDNQVKNHWNTHL 116
                              79********************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129416.7591365IPR017930Myb domain
SuperFamilySSF466891.47E-3016112IPR009057Homeodomain-like
SMARTSM007174.9E-141767IPR001005SANT/Myb domain
PfamPF002494.6E-151865IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.607.8E-231972IPR009057Homeodomain-like
CDDcd001676.24E-112165No hitNo description
PROSITE profilePS5129427.56966120IPR017930Myb domain
SMARTSM007176.1E-1970118IPR001005SANT/Myb domain
PfamPF002491.5E-1871116IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.8E-2673119IPR009057Homeodomain-like
CDDcd001673.33E-1473116No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0001708Biological Processcell fate specification
GO:0032880Biological Processregulation of protein localization
GO:0048629Biological Processtrichome patterning
GO:2000039Biological Processregulation of trichome morphogenesis
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 236 aa     Download sequence    Send to blast
MRMRRRSEER ENHQEYKKGL WTVEEDNILI DYVQAHGTGL WNRIVRKTGL KRCGKSCRLR  60
WINYLSPTVN KGNFTEQEED LIIRLHKLLG NRWSLIAKRV PGRTDNQVKN HWNTHLSKKF  120
VGDYSSAVKT TGEDNSPASL LISAATASNR QHQQDKICAK SFDGLVPASY EKLTHSDVVL  180
GNTNHPSLDF KERNNFDGSN AFWFNEDDFE LVSSFAMMDF ASEKFCNRKS FFYVHS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C5e-291512024128MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLC1427120.0LC142712.1 Brassica rapa subsp. nipposinica GL1 mRNA for trichome differentiation protein GL1, complete cds, cultivar: Kyo-mizore.
GenBankLC1427130.0LC142713.1 Brassica rapa subsp. nipposinica GL1 mRNA for trichome differentiation protein GL1, complete cds, cultivar: Kyo-nishiki.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013725063.11e-136PREDICTED: trichome differentiation protein GL1-like
SwissprotP279001e-111GL1_ARATH; Trichome differentiation protein GL1
TrEMBLK0IRK21e-154K0IRK2_RAPSA; Glabrous 1
TrEMBLK0J1B01e-154K0J1B0_RAPSA; Glabrous 1
STRINGBra025311.1-P1e-122(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM4282646
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G27920.11e-109myb domain protein 0